SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_112276.2.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_112276.2.100692
Domain Number 1 Region: 202-592
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 2.21e-144
Family AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC 0.00000000000237
Further Details:      
 
Domain Number 2 Region: 6-197
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 1.57e-67
Family Inosicase 0.0000000442
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_112276.2.100692
Sequence length 592
Comment bifunctional purine biosynthesis protein PURH [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MASSQLALFSVSDKTGLVEFARNLASLGLSLVASGGTAKAIRDAGLAVRDVSELTGFPEM
LGGRVKTLHPAVHAGILARNIPEDAADMARLDFNLIRVVVCNLYPFVKTVASPDVTVEAA
VEQIDIGGVTLLRAAAKNHARVTVVCEPEDYGAVAAEMQGSGNKDTSLETRRHLALKAFT
HTAQYDEAISDYFRRQYSKGISQMPLRYGMNPHQTPAQLYTLKPKLPITVLNGAPGFINL
CDALNAWQLVTELRGAVDIPAAASFKHVSPAGAAVGVPLSEDEARVCMVYDLYPTLTPLA
IAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIVAPGYEEEALKILSKKKNG
SYCVLQMDQSYKPDENEVRTLFGLRLSQKRNNGVVDKSLFSNIVTKNKDLPESALRDLIV
ATIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKA
GVKRAEVSNAIDQYVTGTIGEGEDLVKWKALFEEVPELLTEAEKKEWVDKLSGVSVSSDA
FFPFRDNVDRAKRSGVAYIVAPSGSTADKVVIEACDELGIVLAHTDLRLFHH
Download sequence
Identical sequences O35567
10116.ENSRNOP00000021105 ENSRNOP00000021105 ENSRNOP00000021105 NP_112276.2.100692 NP_112276.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]