SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_112303.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_112303.1.4139
Domain Number 1 Region: 209-315
Classification Level Classification E-value
Superfamily Cyclin-like 1.06e-32
Family Transcription factor IIB (TFIIB), core domain 0.00000175
Further Details:      
 
Domain Number 2 Region: 115-206
Classification Level Classification E-value
Superfamily Cyclin-like 3.03e-27
Family Transcription factor IIB (TFIIB), core domain 0.000009
Further Details:      
 
Domain Number 3 Region: 9-58
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 4.85e-16
Family Transcriptional factor domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_112303.1.4139
Sequence length 316
Comment transcription initiation factor IIB [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKA
TKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKE
ITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEI
CAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAV
ELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLF
PSDFKFDTPVDKLPQL
Download sequence
Identical sequences A0A1U7QMB5 P62915 P62916 Q3ULN2
ENSRNOP00000015033 ENSMUSP00000029938 ENSMUSP00000029938 ENSMUSP00000029938 10090.ENSMUSP00000029938 10116.ENSRNOP00000015033 NP_112303.1.100692 NP_112303.1.4139 NP_663521.1.92730 XP_004653723.1.11716 XP_005081977.1.91757 XP_005357438.1.66349 XP_006986177.1.50099 XP_007628079.1.28591 XP_007648840.1.69978 XP_008826512.1.79516 XP_021051712.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]