SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_114413.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_114413.1.87134
Domain Number 1 Region: 3-126
Classification Level Classification E-value
Superfamily L domain-like 1.12e-18
Family U2A'-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_114413.1.87134
Sequence length 198
Comment leucine-rich repeat-containing protein C10orf11 isoform 2 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MEKYLSLSGNHSSNKRSLEGLSAFRSLEELILDNNQLGDDLVLPGLPRLHTLTLNKNRIT
DLENLLDHLAEVTPALEYLSLLGNVACPNELVSLEKDEEDYKRYRCFVLYKLPNLKFLDA
QKVTRQEREEALVRGVFMKVVKPKASSEDVASSPERHYTPLPSASRELTSHQGVLGKCRY
VYYGKNSEGNRFIRDDQL
Download sequence
Identical sequences Q9H2I8
NP_114413.1.87134 NP_114413.1.92137 9606.ENSP00000361577 gi|14042939|ref|NP_114413.1| ENSP00000361577 ENSP00000361577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]