SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_174691.2.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_174691.2.80155
Domain Number 1 Region: 123-247
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-31
Family B3 DNA binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 509-588
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000399
Family PB1 domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_174691.2.80155
Sequence length 593
Comment auxin response factor 12 [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MESGNVVNAQPELSGIIDGSKSYVYEQLWKLCAGPLCDIPKLGEKVYYFPQGHIELVETS
TREELNELQPICDLPSKLQCRVIAIHLKVENNSDETYAEITLMPDTTQVVIPTQNENQFR
PLVNSFTKVLTASDTSAHGGFFVPKKHAIECLPSLDMSQPLPAQELLAIDLHGNQWRFNH
NYRGTPQRHLLTTGWNAFTTSKKLVAGDVIVFVRGETGELRVGIRRARHQQGNIPSSIVS
IDCMRHGVVASAKHAFDNQCMFTVVYKPRSSKFIVSYDKFLDAVNNKFNVGSRFTMRLEG
DDFSERRCFGTIIGVSDFSPHWKCSEWRSLEVQWDEFTSFPGPKKVSPWDIEHLMPAINV
PRSFLLKNKRLREVNEIGSSSSHLLPPILTQGQENEQLSVASPMNISLRYRDATEDAMNP
SKLLMSYPVQPMPKLNYNNQMVTEMEENITTKTGTNFRLFGVTLDTPPVIKDPIEEIGSE
ISKLTEGKKFGLSQTLRSPTEIQNKQFSSSRTCTKVQMQGVTIGRAVDLSVLNGYDQLIL
ELEKLFDIKGQLQTRNQWEIAFTDSDEDKMLVGDDPWPEFCNMVKKIFIQKRR
Download sequence
Identical sequences C0SUZ1 Q9XID4
AT1G34310.1 NP_174691.2.80155 AT1G34310.1 3702.AT1G34310.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]