SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_180928.1.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_180928.1.80155
Domain Number 1 Region: 201-312
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000159
Family B3 DNA binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_180928.1.80155
Sequence length 326
Comment AP2/B3-like transcriptional factor family protein [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MKMPPPFSASKTQYLFHDESSENSKKSLVSTTLSLSSCENPNKRKMNSDEVLNISCIPRD
YKLTQVERKIARMRNLSYQEKAEDEWYGVSTELTLFKDPWIIKKVFHFASVLDMAPNSVS
NTHCLLDTESPENAEESLVSLDLCFYDKTWPHDPNVAYNKPTSEEAINLAWMRTMSKRAR
KEEEKYYVSTELTLLTVADPWTLKMAMTKSSIGNLYRLVLKASFVDIHILRYLPLDDQMM
VKEDSGLAVEVYDHDTDSVHNLALKKWAKSSSFVLVSGWRKCFVDRRGLQVGDVIGMYWD
RSESKLHFCVLSRSETMDSAPLPPSP
Download sequence
Identical sequences O23659
NP_180928.1.80155 AT2G33720.1 AR854 AT2G33720.1 3702.AT2G33720.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]