SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_198190.2.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_198190.2.80155
Domain Number - Region: 4-31
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00122
Family PHD domain 0.016
Further Details:      
 
Domain Number - Region: 144-183,224-375
Classification Level Classification E-value
Superfamily TPR-like 0.00841
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 
Domain Number - Region: 88-131,189-275
Classification Level Classification E-value
Superfamily TPR-like 0.0123
Family Tetratricopeptide repeat (TPR) 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_198190.2.80155
Sequence length 390
Comment Tetratricopeptide repeat (TPR)-like superfamily protein [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MGRVHAECDNITNERFKHNNYYCPDCKIQHELAPTILEEQNSVFNASVVHVGQGSSHQVN
GKGIQAAEPKSGSLVLIKGPTKQSFVGYDEAISLFDYFFNESQTLPNMLSCNLIIKAHCD
QGSVDHALELYRHILLDGSLAPGIETYRILTKALVGAKRLDEACDVVRSMSRCDFAVYDI
LIRGFLDKGKFVRASQIFEELKGPNSKLPWRNYHKAIAIFNVSFMDYWFKQGKDEEAMEI
FATLEHAELLNTISGNGVLKCLVEHGRKTEAWELFLDMIEICDSETVGIIMSKEGFFGEK
TIPFERVRRTCYTRMIASLCQQGNMLEAEKLFADMFADVDGDDLLAGPDVSTFRAMINGY
VKVGRVDDAIKTLNKMKISNLRKLSIHQAT
Download sequence
Identical sequences Q3E8X7
AR2869 3702.AT5G28380.1-P NP_198190.2.80155 AT5G28380.1 AT5G28380.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]