SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_201588.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_201588.1.87134
Domain Number 1 Region: 45-198
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.12e-55
Family Dual specificity phosphatase-like 0.0000000384
Further Details:      
 
Domain Number 2 Region: 199-375
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.45e-48
Family Dual specificity phosphatase-like 0.0000000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_201588.1.87134
Sequence length 498
Comment dual specificity protein phosphatase CDC14B isoform 2 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAI
LYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVH
FTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLL
DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY
HQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVKEFL
DICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIGPQQQFL
VMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDD
EINGVTQGDRLRALKSRRQSKTNAIPLTVILQSSVQSCKTSEPNISGSAGITKRTTRSAS
RKSSVKSLSISRTKTVLR
Download sequence
Identical sequences H2PST4 H2R3T7 O60729
ENSP00000364389 gi|15451936|ref|NP_201588.1| HR4745 O60729 9598.ENSPTRP00000046055 9600.ENSPPYP00000021757 9606.ENSP00000364389 ENSP00000364389 ENSPTRP00000046055 ENSPPYP00000021757 ENSPTRP00000046055 NP_201588.1.87134 NP_201588.1.92137 XP_002820045.1.23681 XP_009455213.1.37143 ENSPPYP00000021757 ENSP00000364388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]