SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_312750.1.58667 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_312750.1.58667
Domain Number 1 Region: 10-175
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.9e-17
Family N-acetyl transferase, NAT 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_312750.1.58667
Sequence length 181
Comment TDP-fucosamine acetyltransferase [Escherichia coli O157:H7 str. Sakai]; AA=GCF_000008865.1; RF=reference genome; TAX=386585; STAX=562; NAME=Escherichia coli O157:H7 str. Sakai; strain=Sakai substr. RIMD 0509952; AL=Complete Genome; RT=Major
Sequence
MQAKIAASNTGELDALQQLGFSLVEGEVDLALPVNNASDSGAVVAQETDIPALRQLASAA
FAQSRFRAPWYAPDASSRFYAQWIENAVRGTFDHQCLILRAASGDIRGYVSLRELNATDA
RIGLLAGRGAGAELMQTALNWAYARGKTTLRVATQMGNTAALKRYIQSGANVESTAYWLY
R
Download sequence
Identical sequences A0A0E0U6V3 A0A0E1ST99 A0A0F6CBA6 A7ZTZ2 C3SKL7 E3PNY0 G0F7E9 Q8XAR2
gi|157163264|ref|YP_001460582.1| gi|254163734|ref|YP_003046842.1| gi|251787050|ref|YP_003001354.1| 155864.Z5301 316407.rffC 331111.EcE24377A_4301 331112.EcHS_A4007 386585.ECs4723 413997.ECB_03668 gi|388479457|ref|YP_491649.1| gi|157159420|ref|YP_001465271.1| gi|387885020|ref|YP_006315322.1| gi|471335288|ref|YP_007558765.1| WECD_ECO57 gi|15833977|ref|NP_312750.1| gi|15804381|ref|NP_290421.1| gi|386616601|ref|YP_006136267.1| NP_312750.1.58667 gi|251787050|ref|YP_003001354.1| gi|387614493|ref|YP_006117609.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]