SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_356849.1.86381 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_356849.1.86381
Domain Number - Region: 97-152
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0102
Family NfeD domain-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_356849.1.86381
Sequence length 154
Comment hypothetical protein Atu3773 [Agrobacterium fabrum str. C58]; AA=GCF_000092025.1; RF=reference genome; TAX=176299; STAX=1176649; NAME=Agrobacterium fabrum str. C58; strain=C58; AL=Complete Genome; RT=Major
Sequence
MLQRLATELGPWSWWIVGFVLLAAELIAPGVFLIWIGLAALVIGVVSLFFWEAAFWAWQL
QLVLFAALSVVFALLGRRYFGRNHATSDEPFLNQREASLVGRTATLQEPIVEGRGRIRLD
DTWWPVNGEDLPAGTRVRIASARGRTLTIEPIDR
Download sequence
Identical sequences A0A083ZG51 A0A1G8WEI3 A0A1S7R003 A9CFM6 F5JD24
GO.2543 176299.Atu3773 gi|15891177|ref|NP_356849.1| NP_356849.1.86381 WP_006313449.1.11033 WP_006313449.1.24142 WP_006313449.1.51814 WP_006313449.1.57042 WP_006313449.1.66048 WP_006313449.1.84136 WP_006313449.1.9015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]