SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_445768.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_445768.1.4139
Domain Number 1 Region: 28-84,205-343,384-430
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.63e-75
Family Inositol polyphosphate kinase (IPK) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_445768.1.4139
Sequence length 433
Comment inositol hexakisphosphate kinase 1 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MCVCQTMEVGQYGKNASRAGDRGVLLEPFIHQVGGHSSMMRYDDHTVCKPLISREQRFYE
SLPPEMKEFTPEYKGVVSVCFEGDSDGYINLVAYPYVESETVEQDDTPEREQPRRKHSRR
SLHRSGSGSDHKEEKASLSFETSESSQETKSPKVELHSHSDVPFQMLDSNSGLSSEKISY
NPWSLRCHKQQLSRMRSESKDRKLYKFLLLENVVHHFKYPCVLDLKMGTRQHGDDASAEK
AARQMRKCEQSTSASLGVRVCGMQVYQLDTGHYLCRNKYYGRGLSIEGFRNALYQYLHNG
LDLRRDLFEPILSKLRGLKAVLERQASYRFYSSSLLVIYDGKECRSELRLKHVDMGLPEV
PPLCGPSTSPSNTSLEAGPSSPPKVDVRMIDFAHSTFKGFRDDPTVHDGPDRGYVFGLEN
LISIMEQMRDENQ
Download sequence
Identical sequences Q9ESM0
10116.ENSRNOP00000044935 ENSRNOP00000044935 NP_445768.1.100692 NP_445768.1.4139 XP_006243901.1.100692 ENSRNOP00000044935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]