SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_446380.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_446380.1.100692
Domain Number 1 Region: 6-150
Classification Level Classification E-value
Superfamily UBC-like 3.41e-55
Family UBC-related 0.000000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_446380.1.100692
Sequence length 152
Comment ubiquitin-conjugating enzyme E2 N [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPE
EYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP
LANDVAEQWKSNEAQAIETARAWTRLYAMNNI
Download sequence
Identical sequences Q9EQX9
10116.ENSRNOP00000055805 NP_446380.1.100692 NP_446380.1.4139 XP_004269591.1.21590 XP_019808244.1.83887 ENSRNOP00000055805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]