SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_477354.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_477354.1.81976
Domain Number 1 Region: 174-298
Classification Level Classification E-value
Superfamily TPR-like 2.09e-46
Family Tetratricopeptide repeat (TPR) 0.0000205
Further Details:      
 
Domain Number 2 Region: 308-422
Classification Level Classification E-value
Superfamily TPR-like 1.75e-41
Family Tetratricopeptide repeat (TPR) 0.00066
Further Details:      
 
Domain Number 3 Region: 3-115
Classification Level Classification E-value
Superfamily TPR-like 5.14e-39
Family Tetratricopeptide repeat (TPR) 0.0000607
Further Details:      
 
Weak hits

Sequence:  NP_477354.1.81976
Domain Number - Region: 414-461
Classification Level Classification E-value
Superfamily PriA/YqbF domain 0.0981
Family YqbF N-terminal domain-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_477354.1.81976
Sequence length 490
Comment Hsp70/Hsp90 organizing protein [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MDKVNELKEKGNQALSAEKFDEAVAAYTEAIALDDQNHVLYSNRSAAFAKAGKFQEALED
AEKTIQLNPTWPKGYSRKGAAAAGLNDFMKAFEAYNEGLKYDPTNAILLQGRMETTASAL
SFMQSQGDIPMDVDPQQARSRRAPSPPPAKPAEPPKPAEPRVEDMTEEQKNKYFARKEKE
LGNAAYKKKDFETALKHYHAAIEHDPTDITFYNNIAAVHFERKEYEECIKQCEKGIEVGR
ESRADFKLIAKSFARIGNTYRKLENYKQAKVYYEKAMSEHRTPEIKTSLSEVEAKIKEEE
RMAYINPEKAEEEKEQGNLFFKKGDYSTAVKHYTEAIKRNPDDPKLYSNRAACYTKLAAF
DLGLKDCDTCIKLDEKFIKGYIRKGKILQGMQQQSKAQAAYQKALELDPNNAEAIEGYRQ
CSMNFQRNPQEVLKNAMSDPEIQQILKDPAMRMILEQMQSDPNAVKEHLQNPAIADKIMK
LLESGIIQIH
Download sequence
Identical sequences Q9VPN5
FBpp0077790 FR706 NP_477354.1.81976 FBpp0077790 FBpp0077790 7227.FBpp0077790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]