SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_477469.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_477469.1.81976
Domain Number 1 Region: 10-250
Classification Level Classification E-value
Superfamily TPR-like 6.07e-43
Family Tetratricopeptide repeat (TPR) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_477469.1.81976
Sequence length 302
Comment gamma soluble NSF attachment protein 1 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSGIAAKKIAEAEDLVKQAEKSLKLSMLKWVPDYDSAADEYSKAATAYRIAKSYDKSKEC
FLKAIDAYKNNKSWFHAAKAYEQIILLSKDADKLHEVEEYANKSASLYQQHGSPEAAASA
LDKAAKLTESKHPDMALRFYQHALEVIMIEDSVRQAAEYASKVSRILVKLRRYDEATNAL
KKEISLNQQTESYGQIGRLVVALVMVQLARGDSVEAEKTFREWGNCCEPEEVSTLQTLLQ
AFDDEDPELAARMLASPFIRHMDVEYAILSKNIPLPQGIQMEKKAGDTAAETNDAEDEGG
LC
Download sequence
Identical sequences Q9U6R9
NP_477469.1.81976 7227.FBpp0072096 FBpp0072096 FBpp0072096 FBpp0072096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]