SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_491935.1.50509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_491935.1.50509
Domain Number 1 Region: 3-59
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.000000000000106
Family Transducin (heterotrimeric G protein), gamma chain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_491935.1.50509
Sequence length 62
Comment G Protein, Gamma subunit [Caenorhabditis elegans]; AA=GCF_000002985.6; RF=reference genome; TAX=6239; STAX=6239; NAME=Caenorhabditis elegans; strain=Bristol N2; AL=Complete Genome; RT=Major
Sequence
MDKSDMQRTVDSLRSQLNIERTPITVSAAELRRFTESQEDPLVNPIDKKVNPWAEKSKCS
ML
Download sequence
Identical sequences G5ECT6
F08B6.2 F08B6.2 F08B6.2 F08B6.2 NP_491935.1.50509 6239.F08B6.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]