SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_504355.1.50509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_504355.1.50509
Domain Number 1 Region: 298-354
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 4.97e-21
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00038
Further Details:      
 
Domain Number 2 Region: 5-47
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000204
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_504355.1.50509
Sequence length 354
Comment Prion-like-(Q/N-rich)-domain-bearing protein [Caenorhabditis elegans]; AA=GCF_000002985.6; RF=reference genome; TAX=6239; STAX=6239; NAME=Caenorhabditis elegans; strain=Bristol N2; AL=Complete Genome; RT=Major
Sequence
MAHGNGIAELYKSVMADVIANMKEAFLDENIDVDVLSQLRKEWEDKVNSSGCVDLESNAP
PPAPRQQHHVPPSAVRPNPMPPQRPVAQQPVRALSALHAAHIGDAPIRMAYTGQPTQHPS
QVRMFNPQFQGGIHFQPGQVFVVQQPNGQNIPMSIMPNQIPQHRIIHQGQPQQAQQQQPQ
QGNQLTHMNQMDGNVGSESDGEGPSGPVKLAPKKTKCSLRVRGSGASEKKAMKVLGSLLK
DFQLDGGGGGMSDSSSEDEPDDDDDPLRRIADRMGNGEVEDGDQVAEEEPLNSEDDQSDD
EDLTMLFEADNVVMCQFEKVNRARTKWKFQLKDGIMHIDKKDYCFQKCTGEAEW
Download sequence
Identical sequences O44625
K11D12.2.1 K11D12.2.2 K11D12.2.3 K11D12.2.4 6239.K11D12.2.4 NP_504355.1.50509 K11D12.2 K11D12.2 K11D12.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]