SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_524190.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_524190.2.81976
Domain Number 1 Region: 312-384
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000261
Family PCI domain (PINT motif) 0.023
Further Details:      
 
Weak hits

Sequence:  NP_524190.2.81976
Domain Number - Region: 195-226
Classification Level Classification E-value
Superfamily TPR-like 0.0333
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_524190.2.81976
Sequence length 445
Comment COP9 signalosome subunit 3 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MGSALENYVNQVRTLSASGSYRELAEELPESLSLLARNWSILDNVLETLDMQQHSLGVLY
VLLAKLHSASTANPEPVQLIQLMRDFVQRNNNEQLRYAVCAFYETCHLFTEFVVQKNLSI
LGIRIISRAIDQIRQLETQLTPIHADLCLLSLKAKNFSVVLPYLDADITDISTVAAECKT
QQQQQSQHADANNDAKYFLLYFYYGGMIYTAVKNYERALYFFEVCITTPAMAMSHIMLEA
YKKFLMVSLIVEGKIAYIPKNTQVIGRFMKPMANHYHDLVNVYANSSSEELRIIILKYSE
AFTRDNNMGLAKQVATSLYKRNIQRLTKTFLTLSLSDVASRVQLASAVEAERYILNMIKS
GEIYASINQKDGMVLFKDDPEKYNSPEMFLNVQNNITHVLDQVRQINKMEEEIILNPMYV
KKALGSQDDDLTSQHPKTFSGDPTD
Download sequence
Identical sequences Q8SYG2
7227.FBpp0077927 NP_524190.2.81976 FBpp0077927 FBpp0077927 FBpp0077927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]