SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_524664.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_524664.1.81976
Domain Number 1 Region: 92-214
Classification Level Classification E-value
Superfamily TPR-like 4.02e-31
Family Tetratricopeptide repeat (TPR) 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_524664.1.81976
Sequence length 534
Comment spaghetti [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSAQEKAFELQRQVRQNAREYENSVKDLYSWEQDIKNKEKELQKSPLSAANKDLPVRSHV
QTDKSRKESPSSSAASSPTEKQDLPVDPVAQQYKKANDIKDRGNTYVKQGEYEKAIVAYS
TAIAVYPHDPIYHINRALCYLKQESFDQCVEDCEAAIALDKLCVKAYYRRMQANESLGNN
MEALKDCTTVLAIEPKNIEAKRSLARINDRLRKIATKSGPNFTPDRPGMIEILPIEKPAY
KRSKKAMRSVPVVDVVSPRATIDDSNQLRISDEDIDKIFNSNCGIIEEVKKTNPKPTPMP
DTSGPPKAETIAKTSKEVKPTKQTAVKVAPAVETPKETETRKDTKIVPESDNEAKPSAPK
KTAVEVPKVQTQVSPPKTTIERSPEVNTVQTEKIEQASSNNAMSPSPIERFLPPAPTSTA
QFHVTWKELSGPQKYQYLKSIEVPNLCKILGAGFDSDTFADLLRTIHDFFVPNKEPNTAA
VLLEISKNDEFTILAMLMSAEEKKMVSSILNAIKNWPSKNPAVLDNLFKEYGVA
Download sequence
Identical sequences Q9V3E9
FBpp0072164 NP_524664.1.81976 FBpp0072164 FBpp0072164 7227.FBpp0072164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]