SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_525106.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_525106.2.81976
Domain Number 1 Region: 90-201
Classification Level Classification E-value
Superfamily TPR-like 1.66e-20
Family Tetratricopeptide repeat (TPR) 0.0032
Further Details:      
 
Weak hits

Sequence:  NP_525106.2.81976
Domain Number - Region: 243-298
Classification Level Classification E-value
Superfamily NE0471 N-terminal domain-like 0.0157
Family NE0471 N-terminal domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_525106.2.81976
Sequence length 396
Comment DNA polymerase interacting tpr containing protein of 47kD, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MKQMAAQKAWTDEERLELAAQLDAELDAFIDGLEKKRYEEGWPEDRWQEEMDKHPFFMKR
APQPGDDVHPMFEGLQKLKYDPEENTRDELALNYKEDGNFYMKHKKFRMAIYSFTEGIKT
KTDNPDVLAVLYNNRSAAHFFIKNYRSSLSDAQRALFYKPDYTKARWRSAQCAYELERFD
LCTQMCEELLEVDVDNEVAIALLHKNKMKKLEIERNQRKEAAEAKRRLTRFHRLRDAIEQ
RAIKFDDQKVGKKDVLSEELLYPKFLPLEDHPVHLDEDGSTLIWPAAFSYPEFLYSDFYQ
QLPETTTMRDCLATLLTEKLPYDKAHNYRLGNVHVYYENRKVGCVHKVDEEKQLAEIIAE
KGFFVSGGALLFYVVHKDSRVEQEFINERRRPMVYS
Download sequence
Identical sequences A1Z6M6
FBpp0085479 7227.FBpp0085479 FBpp0085479 NP_001260729.1.81976 NP_525106.2.81976 FBpp0085479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]