SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_566147.3.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_566147.3.80155
Domain Number - Region: 154-220
Classification Level Classification E-value
Superfamily TSP9-like 0.0432
Family TSP9-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_566147.3.80155
Sequence length 391
Comment TPX2 (targeting protein for Xklp2) protein family [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MGESACLMQPFSYAAPQGDSLGALGQSVSFGRFMSEKLDWEKWSAFSTQNPYVAEAERYS
KPGSVAQKKAFFEAHYKKVAAARKAAAEEALLLQQQIPKPQPEKSPVQEEDINEGEKKDW
MVSKPDLEIPRGSLDVSAQLKLLAEKEGRFSNRQSDEKENCGMAESEINGRTAEEQVDEE
KPILKSVKKKSKDSQPKSSTKPRVSKYNSSERTPSKKSNNKSSSYTFTPAKEFNRLVSII
RKIDGSRASSKPTKDCKTPLRTPSNKVSAKGMVEDSLSTPLSSNTSKCRGKIAPNSSAKT
GRGRWNFLPAETPSCFTPFGLRTEERAERRKKKLEGKFKEMETQNQKAEERSVEKEESKL
RQRLCFKAKPLPNFYKQRPKSTDQTKKALLQ
Download sequence
Identical sequences A0A178VEN1 F4J761
NP_566147.3.80155 3702.AT3G01710.1-P AT3G01710.1 AT3G01710.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]