SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_572328.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_572328.1.81976
Domain Number 1 Region: 433-456,507-621
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000816
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 
Domain Number 2 Region: 333-457
Classification Level Classification E-value
Superfamily TPR-like 0.0000217
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_572328.1.81976
Sequence length 686
Comment protein interacting with APP tail-1, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MAGQQLVVLIPKINPNSPKTLYDLSLQALIGSMNTKIPALDRISRLAELPRNLLIDVYEM
MSQQESLKDTLLEELAQLEVFARLVRYPFARSQLLRIMASLMASQKMLAKRLSENYVSRY
EVVAGHEEEELESSMDTVEDRSTEFSSLYTYDSESTNADSISDFNDEFSADIGSIVGLPH
RRATQEELDAINDSGLEELSAVELQVIDLGLRLGSFLSEAGWMQESITVLACLNVRLKDL
PTHKHWLQFRLDCLQRLLYAESAHCNFKEAEKTYAELMGLNKWLNKSVPNQLVAITYSQI
SAMYFARNEYKNSHLWSGLAMRFLKGYANPRTIIDVLRQAAKACVVKRDFARANLLICQA
VRRAREYFGPTHQKYGDALLDYGFFLLNVDSVFQSVNIYKEALAVRRGIFGNMNFHVAIA
HEDLSYAYYVHEYSTGDFSCAQDHVDKAVNIMQHLVPSNHLMLASAKRVKALLLEEIALD
KMADGIDEEDLLLQSEELHNFALLLSLQVFGEVNVQTAKHYGNLGRLYQTMNRFEEAERM
HKKAIKIKSELLGHFDYEVGLSIGHLASLYNYQMKKYRDAEQLYMRSIDISLRLFGNSYS
GLEYDYLGLCHVYETLHNFEKYLKYAHKLENWQMLRGQNLTQNKSSYPAIEVDYSIEEVK
AKYFSMCASKKSAHPSVHEEDTVNEN
Download sequence
Identical sequences Q9W3Y7
7227.FBpp0070906 NP_001259286.1.81976 NP_572328.1.81976 FBpp0070906 FBpp0303990 FBpp0070906 FBpp0070906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]