SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_596896.2.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_596896.2.4139
Domain Number 1 Region: 215-507
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 1.83e-95
Family Cryptochrome/photolyase FAD-binding domain 0.0000121
Further Details:      
 
Domain Number 2 Region: 23-232
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 1.07e-54
Family Cryptochrome/photolyase, N-terminal domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_596896.2.4139
Sequence length 594
Comment cryptochrome-2 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MAAAAVVAATVPAQSMGADGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFA
ASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDS
EPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMEL
PKKPVGAVSSQHMENCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLD
KHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYRKVKRNSTP
PLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDA
IMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSC
SAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCII
GVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPGSSQA
GSISNTGPRPLSSGPASPKRKLEAAEEPPGEELSKRARVTVTQMPAQEPPSKDS
Download sequence
Identical sequences B2GUU9
10116.ENSRNOP00000010142 ENSRNOP00000010142 ENSRNOP00000010142 NP_596896.2.100692 NP_596896.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]