SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_598447.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_598447.1.92730
Domain Number 1 Region: 114-285
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.84e-52
Family NadC C-terminal domain-like 0.0000236
Further Details:      
 
Domain Number 2 Region: 9-113
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 3.92e-25
Family NadC N-terminal domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_598447.1.92730
Sequence length 299
Comment nicotinate-nucleotide pyrophosphorylase [carboxylating] [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MDPEGLQLLLPPTTLAALANSWLQEDCPGLNFASLVTGSAPSQAVLWAKSPGVLAGRPFF
DAIFTQLNCQVSWFLPEGSKLVPVVKVAEVKGPAHHLLLGERVALNTLARCSGIASAAAT
AVEVARSTGWTGHVAGTRKTTPGFRLVEKYGLQVGGAACHRYDLGGMVMVKDNHVVAAGS
MERAVLKARQAAGFSLKVEVECSSLEEAFRAAEAGADLVMLDNFKPEELHPTAATLKARF
PSVSVEASGGVTLDNLTQFCGTHIDVISLGMLTQAAPALDFSLKLFAEGDTPVPHARRF
Download sequence
Identical sequences Q91X91
ENSMUSP00000032912 ENSMUSP00000032912 NP_598447.1.92730 399922 ENSMUSP00000032912 10090.ENSMUSP00000032912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]