SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_599244.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_599244.1.4139
Domain Number 1 Region: 31-244,358-395
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.8e-59
Family Inositol polyphosphate kinase (IPK) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_599244.1.4139
Sequence length 396
Comment inositol polyphosphate multikinase [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MAAEPPALRLRPPGSTGDSPPVPRLLGGCVPLSHQVAGHMYGKDKVGILQHPDGTVLKQL
QPPPRGPRELEFYTMVYAADCADAVLLELRKHLPKYYGVWSPPSAPNDVYLKLEDVTHKF
NKPCIMDVKIGRKSYDPFASAEKIQQQVSKYPLMEEIGFLVLGMRVYHLHSDSYETQNQH
YGRGLTKETLKEGVSKFFHNGFCLRKDAVAASIQKVEKILQWFENQKQLNFYASSLLFVY
EGSSQPATTKSNDRTLAGRFLSKGALSDADVLECNNNFHLFSSPANGTSVGKSLSKAYSR
HRKLYAKKHQSQTSLKVETLEQDNGWKSMSQEHLNGNVLSQLEKVFYHLPAGRQEIAEAE
VRMIDFAHVFPSNTVDEGYVYGLKHLIAVLRSILDS
Download sequence
Identical sequences Q99NI4
10116.ENSRNOP00000000748 ENSRNOP00000000747 ENSRNOP00000000748 NP_599244.1.100692 NP_599244.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]