SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_608419.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_608419.1.81976
Domain Number 1 Region: 26-121,452-540
Classification Level Classification E-value
Superfamily TPR-like 0.00000238
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_608419.1.81976
Sequence length 594
Comment ryder cup [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MKDSSQSAPAGLLVANLKSWETFDWPTEQQRWIYRSWGQYFARMRKNTFAQKYFDKCITE
NESTDHKALYLRSKFKRSVALTQDALEDSLRAMEVRQAWDANVSMELGDALYDLNRFEEN
KSLLHDNVRRHAGTALKSFENRLVVVDENLKDCTGFSLANFFMEHSAQLPGFYAHQQEEL
RRADRRPLWKILKERKECDVQSRIDRKEVMLSPLERERRRRKTKIFYQNYLGRSWTDFFF
LKTLRRHPNCLLDNHFGSSADRTKYLEYAFQRLKTFTRMLQARRPMYKEYFHRNPQIEAR
MRDANLFRIQYQTRRNMVSILRTIKVLRGRNDIKRLRKFVEEVMGSYVVIKTNRLMPWKA
EFMNEVYNNLALSLCEGYRLPPTRVTPYDKSAMCQLLNIPVAKPLEHTELIFGDRSTYSY
AGADKQSTDRLADQNQIEYLEKRLLFARLPIERSYLLHELADRHMQKNHFVQSLSYAQKA
IEEARVCNSLIWEFLSTMLMAKSHAVLHKYERQTEVLNSAYELAAQLKSPQLCTFIELCR
MLNKDYITLRKMSQLVTTKRLRTKISNRSSFLSSPNCSPNFSEFKKEEYGHLAA
Download sequence
Identical sequences Q9VRD3
FBpp0076961 FBpp0076961 FBpp0076961 7227.FBpp0076961 NP_608419.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]