SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_608558.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_608558.1.81976
Domain Number 1 Region: 590-798
Classification Level Classification E-value
Superfamily TPR-like 6.24e-34
Family Tetratricopeptide repeat (TPR) 0.00067
Further Details:      
 
Domain Number 2 Region: 753-932
Classification Level Classification E-value
Superfamily TPR-like 3.29e-23
Family Tetratricopeptide repeat (TPR) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_608558.1.81976
Sequence length 938
Comment CG4341, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MPSLEPWLWGDSCSWLGMLAMLRLRLHKSNMDFTCLFCCSLAFVLYLNTLGAGFVYDDRR
AILANADVSGGTPWQRSFSNDFWGTPLTDSGSHGSWRPLCVLSFRLNYLIGGGFAPWGFH
LVNNLLHCVATALVVRVARTLLASVWAVLAAGALFAAHPIHTEAVAGVVGRADLAACVCY
LLTYLSYLRHMRWRESGDPRQWLALGATLILAAAGLLCKETAITALLVCALFDVMRGLSG
QVDKQRLRSVCIVLGALFCMAYCRLVIVPGPQTAFSSADNPIARTPSAWTRLLTFLYLPV
FNLRLLLQPNVLSFDWGMDALPRVTSLWDRRNAQSACFYSVLVGVAWGSCRQLLSGSKEV
THCGVSSTFPQYHIQKVASRKSRSKRKRLANNTKYQAFEAAYHQQQQEALPCRDCNNNNS
SGYVYEGSSPVAQAPAQAPHLVSSAFRGSRSSSSCSNSTNSSSSSSSSSSSSSSSSSSLS
GGFQCSSKDYALEGMSPANRHACVLIMSLSFLALPFLPASNLLFYVGFVVAERLLYLPSV
GFCLLVGYGVSKLMSCNQRTRNILLLSFSLLLAAMSLRTLRRNADWRDEESLYRSAIAIN
PPKALGNLGSVLSSQGRYEEAKQVLQEAIRFRPNMADVHFNLGILHQNQQVYPAAVECFQ
RAIKFRPNLAVAYLNLGISFIALGKRQQAIEILQAGSNLDGAAVRDRTAHDQARSSAYLQ
LGALYVEQGKLQRALAIYREALSSLPGLPQQREILYQRIGDVLGRLQQWDEAERHHRAAL
ELQPNQVAAHLSYGITLARNSSRASEAEMWFKRALKLAPEQASVYHHYAEFLSLQSRHHE
SAIYHRRAAELAPNDYTLVVAAATAMRLLDRKVDAEMWYRKAVALRPGDAHAHTNLGAIL
HLLGRTNHAAASYKAALRLQPGDAITLGNLAKLGVTNV
Download sequence
Identical sequences Q9V3X5
FBpp0077614 FBpp0077614 FBpp0077614 NP_608558.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]