SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_609037.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_609037.1.81976
Domain Number 1 Region: 110-264
Classification Level Classification E-value
Superfamily TPR-like 0.00000000854
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_609037.1.81976
Sequence length 306
Comment coat protein (coatomer) epsilon [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSRQQNEEDTNSVLFDARNEYYIGNFMGSINFVLPEQGTAGPELLSYMYLSYLAIDSGRI
VASDIKEGNSTPLQALRLVHEAFEQPSRTEELLEKLTDKVAGEEDETNIWHLATAIVYCH
DGQFENALKILHGSTNLESMALSVQCLLRLQRVDLAKQLVAKMQEISDDATLTQLAQAWV
ALAQGTEQMQDAFHIYQEFCEKFKPTPALLNGQAVVHLGLERYEEADSVLRESLLKKHND
YDTLINLMVHAHLTGKPTEAITRNLEQLRQFYPKSDFVTDLDKKSAEFDRLCLQYDVEGG
EKLLAV
Download sequence
Identical sequences Q9Y0Y5
FBpp0078891 FBpp0078891 NP_609037.1.81976 FR729 FBpp0078891 7227.FBpp0078891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]