SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_610036.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_610036.2.81976
Domain Number 1 Region: 318-480
Classification Level Classification E-value
Superfamily TPR-like 4.17e-30
Family Tetratricopeptide repeat (TPR) 0.0064
Further Details:      
 
Domain Number 2 Region: 162-365
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000142
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Weak hits

Sequence:  NP_610036.2.81976
Domain Number - Region: 456-544
Classification Level Classification E-value
Superfamily TPR-like 0.000835
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_610036.2.81976
Sequence length 678
Comment cell division cycle 23, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MAMQKFFSVLLPDVKRELRRGIIECSKRGLLHSTKWLAEMHHGLADVHIDNEAPDEDRTF
SECQLEGIAPEEYSDYFLAKSYYDVREYDRAAHAVRNCESSVPRFLHFYSSYMAREKRRL
DSTTDQANLHEPNQMRDLADLLATLRMEYGKSRLDGYGIYLYGVVLKALNLNQAAEQMLV
QAIRLVPMLWSAYLELSPLIMEKKKLLSLQLGGHWMRHFFMAHTYLELYLNDDGLKIYED
LQASGFSKSIYLIAQMALVYHNKRDVDKAIELYQALLESDPYRLDNVDTYSNLLFVKEMK
TEMAQLAHKAVSINKYRPETCCVIGNYYSIRCDHQVAISYFQRALKLNPKYLAAWTLMGH
EFMELKNTNAAIQSYRKAVEVNKRDYRAWYGLGQAYEIIKMHYYSLYYFKIAHQLRPYDS
RMLVALGETYEKLDKCENAVKCYWKAIDVGDIEGIAMYKLANLHEKLGDHETAVHCYIMY
CEDERAATDKQSLYQGFITLANYYEKKGEYERAAYYAYKCLDSEDRKMEAKALLKTIDWK
RNAEGQKKVKTSTAVANADTSSEDEMEWELQDVRVRVPITSIATTTTSTTTVAAESASSS
SLISLRPDRNLIQGMRRSQSSRTSLTAPASGTTTTPSATAVTMSTEETPGTSGGPSNPPE
QAPSDDNSSMEISSVSID
Download sequence
Identical sequences Q9I7L8
FBpp0080894 FBpp0080894 NP_001260629.1.81976 NP_610036.2.81976 7227.FBpp0080894 FBpp0080894 FBpp0305185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]