SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_610452.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_610452.2.81976
Domain Number 1 Region: 402-614
Classification Level Classification E-value
Superfamily TPR-like 1.02e-25
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Domain Number 2 Region: 747-870
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000455
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Domain Number 3 Region: 912-1050
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000569
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 
Domain Number 4 Region: 18-63,252-372
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000862
Family Tetratricopeptide repeat (TPR) 0.047
Further Details:      
 
Weak hits

Sequence:  NP_610452.2.81976
Domain Number - Region: 19-205
Classification Level Classification E-value
Superfamily HCP-like 0.00136
Family HCP-like 0.033
Further Details:      
 
Domain Number - Region: 586-689
Classification Level Classification E-value
Superfamily TPR-like 0.022
Family CT2138-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_610452.2.81976
Sequence length 1233
Comment CG8777 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSAVKESKALIKDIRETIKLGKHAEAIPKCQRLLKSEPENAMGYLLLGAAYQNIDKAEAA
KNLRQCIKCTDGPAPAALLGLANCAPSNELPEIYDQLADLQPEQSLNYWEKLFNLASDSN
VAPFCFTVLKKRVQDTENGNFTKIQEYLGRIWVSNDFEIAPEDTQLYKTTMEALLQNSEP
SARSVVYKRYLKWLYKKQDYETCVRHACNMTESHPKDVYGFEWICKTYCEHHEQSEIVSW
QQELRHPIQVYAEQLLELNPNSNLALLVKALDLFAEGQVVASRQLALQAQKSQPAYKVTL
ELLARIHMELGAYKLALQLWQEIGQENDAYALCLSHEKGVSKLREAVTILQTLENSEGNI
KSLARCYFKLGELHLLKDLPLDDLTKAEFVLSPSEALQEIADCKTFEAYLLCGKLHMALK
NYSDALNYVLKATRLRPHFAECFDYLGKLYPLATGDFSRARKCYEKCISLNPLAEEAVDA
LSFIYQEQGEEELNETLLLNTLSHLGSNESIRLQYKLGLHFSHVKKWDSAIQCFRIAIKN
DSRCISYWESLGDAYAGRGSYNSAIRVFQKILELSPENNYALLQIASVKTTIRMYTESIE
DYDTLLQRNPTYLPGLRGAAEAHIGIANSLKSQNLYGRSKAHFQLALEHLQSAFLQREAQ
GMVWLWRLSANIFVQTAQLPHSLANLDVAGNLAKREEPIAYLSRKDLLQLAQRFYLCALK
LKQNTYLWYELSLASYYSAILIPEDANGHLETATKACKMAIKECSNRWQNWNLLGVINMN
SENENLPLAQHCFIQAVVLEKKCYTAWTNLGVLYIKLNEVRLANEAFTRAQQSSPVYANA
WIGQAMVAELIGDREEAFDLFRHCQQFDYHPEAALGFAHWVCEMLSTPGSFDKPRIKHAI
EHMYADVLALDAINWYVQNEETDATPASLSFQGFLYARKNLYRQAIEAFTRACKLCEPGA
DRDKLYTNLGYLYLKIDQPEQAAHALNTVAHATFKPIIGLAQAYYLAGQLQESYSIYNSV
LGNVVDHGDDKAATILVAMASMIYDFQGEADTKTLLYQCVLLKEVPIQALFSALALGILH
RDNALIHTILTELNAYAFKKEYCADISYLTAHYILINEGARRALCYLQTRIRMFPNSRSL
RSVVLKFLLDYFSDDQSYRLATSNMGRITLTLGHTKQQNSILASEEALTTIYASQAVSAV
DKTCSMKLLQRAILLSPTDQRARQLLSAIIANS
Download sequence
Identical sequences Q6NNB2
FBpp0087646 FBpp0087646 FBpp0087646 NP_610452.2.81976 7227.FBpp0087646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]