SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_610730.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_610730.1.81976
Domain Number 1 Region: 183-231,410-489
Classification Level Classification E-value
Superfamily SET domain 3.01e-20
Family Viral histone H3 Lysine 27 Methyltransferase 0.033
Further Details:      
 
Domain Number 2 Region: 223-273
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000314
Family MYND zinc finger 0.02
Further Details:      
 
Domain Number 3 Region: 69-138
Classification Level Classification E-value
Superfamily TPR-like 0.00000928
Family Tetratricopeptide repeat (TPR) 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_610730.1.81976
Sequence length 573
Comment SET and MYND domain containing, class 4, member 4 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MDVYDVSDDLIKKLQDWKLIGIISGKFNELKENHRKVDFVMRALIDFKYIEKIFLNVTLR
EDKCNKRSVEFRMLGNEQFSLKNRNYFQALELYNKSICYAEPNSEHLSIGYANRSAVLFE
WKRYRQCLDNIKLARQANYPARLSHKLDKRERDCQQLLDQQPPDVVPYEFKLSFEPHAQV
PFIADCLELRETAAEGRFVVTNRDLAVGDLVSVEEPFCSTLLTPMRYIRCATCKRENYLT
LIPCDSCCSTMFCSEECKSIAMQTYHRYECPIIDFLNRMFNKIHCIALRTTLVALNIFPS
IEELIDFCEQEQNQDKCAFDLNYNELTPEEHYRAIHGLVTNQHLRSVSDLFQRSVVCAVL
KHFIIEYTPVKEYLGGEEGVNFFTDLLFRHLQTSPSNMHGIDLVEQVNETKDDQTHSSGA
YAFLSLINHSCAPNTVRIYEGTKAYMFVLRPIKAGNVLYDNYGAHFAICSKEQRLKRLSL
QYRFDCKCEGCELNYPMFGMMPHKATVPSVTDDTELALSSYNYDFAVSNYRKYCDFLTQY
GDDYPCEQISSAEECLKMALHIMADAVPLKAKM
Download sequence
Identical sequences Q7KMH5
FBpp0087091 FBpp0087091 FBpp0087091 7227.FBpp0087091 NP_610730.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]