SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_611441.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_611441.1.81976
Domain Number 1 Region: 25-128
Classification Level Classification E-value
Superfamily TPR-like 0.00000901
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 
Weak hits

Sequence:  NP_611441.1.81976
Domain Number - Region: 451-522
Classification Level Classification E-value
Superfamily TPR-like 0.0794
Family Tetratricopeptide repeat (TPR) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_611441.1.81976
Sequence length 580
Comment uncharacterized protein Dmel_CG15128 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MTSIVEMPRANLEEALPPWMKIDWSDEVLHDIYRDWGTYYSRRRRENFALHYLNKALALE
PTDHMTLYKRCQSKRKAAQMLGALDDSRAAAKLARSKDGEEKAIINLDICDVLYELNQFE
NSKAEMHNNMRVFIGNKRKSFEQRQLVVDGVIKDVTGEAMSAFFTKNLKTVSIVHDLIKE
RERVDNRPLWKRLKEQGKCDVQSIPEVPEEMLSPMEIARRKRAFNIFHQSYINDSWIDVL
FMKMLCKNPNLLLPQCKESSYFLQQLSSKQYEIVRKFMKMLQSRSPLYLVNYLKYGNKAM
SDKYREAYLFRVQYQTHRNMNHALKEIRALRKAKKVQQLAKFVEELMGTYVVLKTARVMC
WKFEFLNEVYNTMALTLAEQLRVPKGFTPYGSNAILKLLRLPVERVKDFVPVTFGDRAPE
PEGNDPATTRAKRLTARLEHRMVFAKYSIEKCYLLHQISQSYLDQGRHSECTYNARKAIK
ESKNCNSNLWKFLSVVQIVKANAILHKLEQTKEALEDALPIAHFLKSSELILFIENCMAC
NTEDSINKRATLMQARRVSKSESVATHSLVSGQDVDSQGG
Download sequence
Identical sequences A1ZBP5
FBpp0085676 FBpp0085676 7227.FBpp0085676 NP_611441.1.81976 FBpp0085676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]