SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_611460.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_611460.1.81976
Domain Number 1 Region: 3-176
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.62e-44
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000391
Further Details:      
 
Domain Number 2 Region: 361-557
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.93e-43
Family Pyruvate oxidase and decarboxylase PP module 0.0000288
Further Details:      
 
Domain Number 3 Region: 188-344
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.42e-39
Family Pyruvate oxidase and decarboxylase, middle domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_611460.1.81976
Sequence length 568
Comment uncharacterized protein Dmel_CG11208 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MAEVEAVQIIAESLKQQGVEYVFGIIGIPVIELSMAFQAAGLKYIGMRNEQAACYAAQAI
GYLTGKPGVCLVVSGPGLLHVTGGMANAQVNCWPLIVIGGATNQDHEGIGGFQECPQVEL
SRPYCKYAARPATAALIPLHVEKAVRYATYGRPGVAYLDFPGNILQSKAQEASIYKALAH
PAPPLAYPPHDDVIRAAKLLRQAKRPLVIVGKGSAYAHAENTLRHFIENTNLPFLPTPMG
KGVVSDTAPQCVSSARTLALQKADVVLLLGARLNWILHFGKAPRYDKDVKFIQVDINPEE
LHNSVVASVAIQADIRPFAEQLFEQMNAVNFRFGYEQDWWKQLAVKCKQNRDTVQKMSLN
TETPLNYYAVFHHLRELLPKDTIIVSEGANTMDIGRSMLLNEQPRHRLDAGTFGTMGVGP
GFAVAAALFCRDFAPGKRVLCVEGDSAFGFSGMEIETMVRYKLPVTIVIVNNNGIYGGFD
KDTFEAIRSEGDLTQITPPSALGVQVRYEEMMKMFGMKGYFCTEIEQLQAAVKAANQLTD
RPTIINVAISPSSDRKPQSFNWLTESKL
Download sequence
Identical sequences Q7K3B7
7302414___KOG1185 FBpp0085630 FBpp0085630 NP_611460.1.81976 FBpp0085630 7227.FBpp0085630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]