SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_648174.3.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_648174.3.81976
Domain Number - Region: 263-379
Classification Level Classification E-value
Superfamily TPR-like 0.0252
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_648174.3.81976
Sequence length 702
Comment CG7927, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSARMLKKLQGDADKLAPPPDDEDCEELSDNDELEDSDMQRYRKSHLNPFDLLNQAGLSL
SESEFKEDDNETEHPSAALPNATASAAKKKKKKRKKKAKSSGNHISSEDNERQDKYFEKV
DPLLGKVYDAVPRQSAKQLVSAATGTTATKKLLAVELRHLNPQNEMRRTFGKRVVKVETK
RGRQKPTLKSTYMVTAKDSWPALTKNTITMKLLPAPDSPSVSSKSITDNGADVQWFAFEH
SQYYQGVQQMFLSALERIDSEFLITLIKRCPYHVDSLVQLSEVCKMTEDFSLASELLERA
LLLLESSLHINFSLTSGNCRLDYRRQENRSFYIVLFKHAQYLEERACSRTAFEISKLLLS
LQPDTDPLAMILVIDYYALRSKQFEWLVEFYEKYNAARNLNQLPNMAYSYALALHTLYGA
CERSNQALQYALLMFPGVLRPLLDEMSVQTDKRVLASSYFFADVSGNQSPALHQLVCLYV
CRARVVWRQNEVLPWLESNVNIVLDRIESKDPLVNEYKEKRSLRYSGTPPRPILRHVILS
DYKEKVPLAVFVSKEKQAIMTYDPLPPPNSVNCYHRKSSSSSSPTTNTNNSVSMFFQSLL
PSFNINNLAANAQLQEGAAPAAGAGAAAGDANIEVGIEQGAAGVAGEGEEAGLQQSLTLM
MDAMRDFLQNFRIAEHLRSPETAAAQSTSSNDEEEGSSDYID
Download sequence
Identical sequences Q9Y109
FBpp0076407 7227.FBpp0076407 FBpp0076407 FBpp0076407 NP_001261558.1.81976 NP_648174.3.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]