SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_649916.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_649916.1.81976
Domain Number 1 Region: 390-492
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.62e-26
Family Chaperone J-domain 0.00041
Further Details:      
 
Domain Number 2 Region: 38-258
Classification Level Classification E-value
Superfamily TPR-like 4.34e-26
Family Tetratricopeptide repeat (TPR) 0.003
Further Details:      
 
Domain Number 3 Region: 282-393
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000038
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_649916.1.81976
Sequence length 498
Comment P58IPK [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MALPLSDLLMIGGGEKKLAACLVLLLLELFLEGAESTASPADIENHLELGKEFLARGQLS
DALTHYHAAVEGDANNYLTLFKRGTVYLALGKTRFAVQDFSRVLELKPDFMAARIQRGVV
HMKSGEYEQAIQDFDQVLQEEPNNGLVLEHYSRLAPAQEQWVLVQQLIQYSDHQNAIPMI
TQLLEISPWAVPFRQARSDAYIAINDPLLAIADLRQVNRLTQDSTEGHYKIAQLLYTIGH
ATNALKEIRECLKFDPEHKLCFPFYKKLRKVEKQLVNAEQAREEKHFAECIAAGEAVLRN
EPEETMIRYEGHKVLCTCYTGDEQFGKALQQCKEALDIMKDAQVYCDRADALLGTEMYDD
AIHSFQAALDLEESNTRAKEGIQRAKKLQKQSERRDYYKILGVKRSASKQEIVKAYRKAA
QKWHPDNFRDEEKKVAEKKFIDIAAAKEVLTDPEKRRQFDNGEDPLDPESNQRGGFHGEH
PFGHFQHGSPFQFKFHFN
Download sequence
Identical sequences Q9VHA8
FBpp0081552 FBpp0081552 NP_649916.1.81976 7227.FBpp0081552 FBpp0081552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]