SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_650486.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_650486.1.81976
Domain Number 1 Region: 173-268,301-360
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000299
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 
Domain Number 2 Region: 380-466
Classification Level Classification E-value
Superfamily TPR-like 0.0000114
Family Tetratricopeptide repeat (TPR) 0.046
Further Details:      
 
Domain Number 3 Region: 79-157
Classification Level Classification E-value
Superfamily TPR-like 0.000091
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_650486.1.81976
Sequence length 570
Comment CG4525 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MILSRGKTDSASSRNASGGPGSGLGVGRQARKTPAPASLEDFIIRRDYTGARAFLEFAND
DEDEEEGAHGSKQSQVDQWIAFCNFHLGDYQQALAQYKAIQQGSSTPDGKLDLNLAVCMF
YLGLYEEAQQLMANAADNPLKQRLLFHLAHKLGNEEEWSQLQEELQDSSSLEQQLSLASM
HYMRAHYQEAIDVYKRVLVDNKEYQAINVYLALCFYKLDYYDMSQEVLDVYLSQHGDSTI
AINLKACNRFRLFNGRVAEQEIKNIADNGTFGADLLRHNLVVFRNGEGALRVLPGLLNII
PEARLNLAIYYLKQGDVQEAHALMKELQPTSPHEYILKGVVHAALGQQLGSKEHIKTAQQ
NLHLVGSSATECDTIPGRQSMASAFFLYEQFEEVLVYMNSIRSYFVNDDVFNYNFAQAKC
ATGYYKEAEELLMQISDMDIKNQHTYCMILAKCHIHCGHPELAWNVFITRDTNAEAFILL
QLIANECYKCAEFWVAAKAFDMLEKLDPSPENWEGKRGACAGVLFALCTKAQRGRPGGGI
SEVIGILRDSSNSQAEAMIKTIRKHINHFK
Download sequence
Identical sequences Q9VF41
FBpp0082624 NP_650486.1.81976 FBpp0082624 FR730 FBpp0082624 7227.FBpp0082624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]