SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_650581.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_650581.1.81976
Domain Number 1 Region: 82-239
Classification Level Classification E-value
Superfamily TPR-like 1.23e-18
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_650581.1.81976
Sequence length 282
Comment uncharacterized protein Dmel_CG17556, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSLDYEKMSWSDVRDQFRTWREETGRHSEEVVQLWVAVLEDKVHKTGNERHLILEQVIIA
ALDTARFDIATKCTKQLSLEFPGSLRVMKFKAMRYEALEQYDEADEVLDAIIAKDETNAA
PRKRKIAILKARGRRLEAIKELNEYLKKFMSDQEAWHELCNMYLAEGEFGKAAFCMEEVL
LHNPHSHLIHQRLAEIRYTMGGVENMESARTYYSQALKLNPHNLRALYGIYLCCNHLDNS
RAVSSKRKELQKLSQWALEQLLTKQTIVPLEAAFGNLEIKSN
Download sequence
Identical sequences Q9VEQ1
FBpp0082818 FBpp0082818 FBpp0082818 FR693 7227.FBpp0082818 NP_001262652.1.81976 NP_650581.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]