SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_653272.2.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_653272.2.87134
Domain Number 1 Region: 14-127
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-28
Family Pleckstrin-homology domain (PH domain) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_653272.2.87134
Sequence length 249
Comment sesquipedalian-1 isoform 2 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MKLNERSLAFYATCDAPVDNAGFLYKKGGRHAAYHRRWFVLRGNMLFYFEDAASREPVGV
IILEGCTVELVEAAEEFAFAVRFAGTRARTYVLAAESQDAMEGWVKALSRASFDYLRLVV
RELEQQLAAVRGGGGMALPQPQPQSLPLPPSLPSALAPVPSLPSAPAPVPALPLPRRPSA
LPPKENGCAVWSTEATFRPGPEPPPPPPRRRASAPHGPLDMAPFARLHECYGQEIRALRG
QWLSSRVQP
Download sequence
Identical sequences Q8N4B1
9606.ENSP00000354461 gi|24432056|ref|NP_653272.2| gi|295821167|ref|NP_001171468.1| NP_001171468.1.87134 NP_001171468.1.92137 NP_653272.2.87134 NP_653272.2.92137 XP_006719320.1.92137 XP_011536278.1.92137 XP_016874372.1.92137 ENSP00000376426 ENSP00000447353 ENSP00000449994 ENSP00000447353 ENSP00000449994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]