SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_680167.1.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_680167.1.80155
Domain Number - Region: 65-108
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0118
Family Methyl-CpG-binding domain, MBD 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_680167.1.80155
Sequence length 124
Comment hypothetical protein AT5G13825 [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MEAESSSSGHRRQKRPRQKRSSDVISYESSVANLSREGKETLMIVSRRRQLNKIPNTSST
VFDNTCPRYNWLRSGWIAEERLKVYDRLYRYFYDPLGQMYHTRGEVDQIYADIEKSRAIV
VFRK
Download sequence
Identical sequences A0A178UKC3 Q5XV41
3702.AT5G13825.1-P NP_680167.1.80155 AT5G13825.1 AT5G13825.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]