SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_681934.1.97157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_681934.1.97157
Domain Number 1 Region: 124-318,414-564
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.11e-109
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000729
Further Details:      
 
Domain Number 2 Region: 296-429
Classification Level Classification E-value
Superfamily GAD domain-like 3.27e-34
Family GAD domain 0.0017
Further Details:      
 
Domain Number 3 Region: 1-105
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.1e-32
Family Anticodon-binding domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_681934.1.97157
Sequence length 605
Comment aspartyl-tRNA synthetase [Thermosynechococcus elongatus BP-1]; AA=GCF_000011345.1; RF=reference genome; TAX=197221; STAX=146786; NAME=Thermosynechococcus elongatus BP-1; AL=Complete Genome; RT=Major
Sequence
MRTHYCGDVRLRDVGTTVTLYGWVDRRRDHGGVIFIDLRDRSGIVQIVSDPQRTPDAYPQ
AERLRSEYVVKVVGRVSKRPADSVNPKLATGDIEIYADGIEVLNTVRQQLPFAISSTENE
EVREEVRLRYRYLDLRRERMARNLRLRHRVVQAMRRFLEDEAGFIEVETPILTRSTPEGA
RDYLVPSRVNPGEWFALPQSPQLFKQLLMVAGCDRYYQIAHCFRDEDLRADRQPEFTQLD
MEMSFMDQEEILDLNEALICHIFKTVKGIELPRPFPRLSYQEAMDRYGTDKPDTRYGLEL
VDVSDILKDSGFKVFSGAIAQGGVVKILPIPNGSDRISNVRIKPGGDLFQEATTAGAKGL
AYIRVRNNGEIDTIGAIKDNLSPEQKALLLERTGAQPGHLLLFGAGETATVNKTLDRLRQ
TIAREFNLIDPTATHLLWVVDFPMFEWNAEEKRLEALHHPFTAPHPEDLGDLKTARAQAY
DLIFNGHEVGGGSLRIHQPELQRQVFEIIGIDEATAQEKFGFLLEAFEFGTPPHGGIAYG
LDRLVMLLAGADSIRDTIAFPKTQQARCLLTGAPSSVEPQQLKELHVTPAKPAKTTAKTK
PRPAD
Download sequence
Identical sequences Q8DJS8
gi|22298687|ref|NP_681934.1| NP_681934.1.97157 197221.tll1144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]