SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_682286.1.97157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_682286.1.97157
Domain Number 1 Region: 3-238
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.24e-78
Family SAICAR synthase 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_682286.1.97157
Sequence length 243
Comment phosphoribosylaminoimidazole-succinocarboxamide synthase [Thermosynechococcus elongatus BP-1]; AA=GCF_000011345.1; RF=reference genome; TAX=197221; STAX=146786; NAME=Thermosynechococcus elongatus BP-1; AL=Complete Genome; RT=Major
Sequence
MTQFSPLYEGKAKIIYATADPDVLLAEFKDDATAFNAQKRGSIQNKGVMNCAIASHLFQY
LAAQGITNHFIAQVAPNKMHIRRVEIIPLEVVVRNQAAGSLCRQTGLPLGLALNPPLVEF
YLKNDDLGDPLLTPDRLRLLQVATDEEVIQIRQMALAVNTHLSHFFAECGITLVDFKLEF
GRRPTGEILLADEISPDSCRLWNRDESDPEKRILDKDRFRQDLGAIEEAYALVMQRVLAH
SVS
Download sequence
Identical sequences Q8DIT5
NP_682286.1.97157 197221.tll1496 gi|22299039|ref|NP_682286.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]