SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_682406.1.97157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_682406.1.97157
Domain Number 1 Region: 12-232
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.06e-59
Family PP-loop ATPase 0.00018
Further Details:      
 
Domain Number 2 Region: 212-316
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 3.14e-19
Family MesJ substrate recognition domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_682406.1.97157
Sequence length 344
Comment hypothetical protein tlr1616 [Thermosynechococcus elongatus BP-1]; AA=GCF_000011345.1; RF=reference genome; TAX=197221; STAX=146786; NAME=Thermosynechococcus elongatus BP-1; AL=Complete Genome; RT=Major
Sequence
MWGIHHARLHTTLKTQQWLPLGSRILIALSGGQDSVCLTRLLLDLQPHWQWSLVAVHCDH
RWRADSTANANFVQQLAQKWHLPCEVVSAPDLPKTEAAARSWRYQVFESVAKALDCTHVV
TAHTQSDRAESLLLHLLRGTSPDGLATLLPSRSLGAIQLVRPLLGMTRAQTAAFCQAYGL
PIWQDETNHNLEYRRNRLRLELIPYLQQHFNPNVEEALAQTAELLASDRAYFEAEVERLA
PTVLREHPPALDRLRLREFPLALQRRLIQCFLRQHLKRGLNFRVIEAVRALMTTGNGSQT
ASLPGGQHLRVCGRWIELVRPMPPPPAPVPPDPGERSPPPSPLY
Download sequence
Identical sequences Q8DIH2
NP_682406.1.97157 gi|22299159|ref|NP_682406.1| 197221.tlr1616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]