SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_682462.1.97157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_682462.1.97157
Domain Number 1 Region: 16-499
Classification Level Classification E-value
Superfamily ADC synthase 2.35e-156
Family ADC synthase 0.000000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_682462.1.97157
Sequence length 506
Comment anthranilate synthase component I [Thermosynechococcus elongatus BP-1]; AA=GCF_000011345.1; RF=reference genome; TAX=197221; STAX=146786; NAME=Thermosynechococcus elongatus BP-1; AL=Complete Genome; RT=Major
Sequence
MYPDFQTFCQLAEQGNFIPLYEEWVADMDTPVSAWYRVCRDRPYNFLLESVEGGEQLARY
SLLSCDPLWVLETRGNQTTQTHRDGSVTRFTGNPFTILANCLAPYQPVKLAQLPGGIGGL
FGFWGYELIQWIEPRVPIHPATARDLPDGVWMQVDQILIFDQVKRKIWAVVYADTRETDL
KTAYTHASDRLERLLRKLQTRIPPEATQLHWQPSRQIPSYTSNITSEAFRTNVARAKDYI
RAGDIFQVVLSQRLSATYRGDPFALYRSLRLINPSPYMAYFQFGTWQIIGSSPEVMVKAE
HHPENAGSLLATVRPIAGTRQRGHTYTEDQQLAAELLADTKEVAEHVMLVDLGRNDLGRV
CRQGSVSVEAFMVIERYSHVMHIVSNVVGELLPDKTAWDLLQACFPAGTVSGAPKIRAME
IIYELEGCRRGPYSGAYGYYDFEGQLNTAIAIRTMVVQPLTDHQHLIHVQAGAGIVADSD
PQREYEETLNKARGLLEAISALTTKP
Download sequence
Identical sequences Q8DIB8
NP_682462.1.97157 197221.tll1672 gi|22299215|ref|NP_682462.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]