SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_682794.1.97157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_682794.1.97157
Domain Number - Region: 320-349
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0259
Family Rubredoxin 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_682794.1.97157
Sequence length 390
Comment transposase [Thermosynechococcus elongatus BP-1]; AA=GCF_000011345.1; RF=reference genome; TAX=197221; STAX=146786; NAME=Thermosynechococcus elongatus BP-1; AL=Complete Genome; RT=Major
Sequence
MEKAFSYRFYPTTEQESLLRRTLGCVRLVYNRALAARTEAWYERKERLDYVQTSALLTKW
KKQDDLQFLNEVSSVPLQQALRHLQSAFSNFFAGRAKYPNFKKKRNGGSAEFTKSAFRWK
DGKVFLAKCNEPPNILWSRRLPDGVEPSTVTIRLNPAGQWYISLRFDDPRDLTLQPVDPS
VGLDVGMSSLITLSTGEKIANPKHFNRYYKRLRKAQRSLSRKQKGSRNWDKARLKVAKIH
QKISDSRKDHLHQLTTRLIRENQTIIIESLAVKNMVKNRQLARSISDAGWGELVRQLEYK
AQWYGRTLVKIDQWFPSSKRCGQCGHIVERLPLSVREWDCPKCGAHHDRDVNAAQNILAV
GHTVTVCGAGVRPDRHTSGGQLRRSRKSQK
Download sequence
Identical sequences Q8DHF5
gi|22299547|ref|NP_682794.1| NP_682794.1.97157 TeR224 197221.tll2004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]