SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_682945.1.97157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_682945.1.97157
Domain Number 1 Region: 252-499
Classification Level Classification E-value
Superfamily HemD-like 1.28e-73
Family HemD-like 0.0043
Further Details:      
 
Domain Number 2 Region: 2-227
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 3.01e-50
Family Tetrapyrrole methylase 0.0000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_682945.1.97157
Sequence length 501
Comment porphyrin biosynthesis protein [Thermosynechococcus elongatus BP-1]; AA=GCF_000011345.1; RF=reference genome; TAX=197221; STAX=146786; NAME=Thermosynechococcus elongatus BP-1; AL=Complete Genome; RT=Major
Sequence
MGAGLGTPSSLTLEAWTCLQQAQVVLYDALLSPSLLELTPADCLRVAVGKRAGAEAIPQL
EINRLLVAYGQQYQRVVRLKSGDPGLFGRLHQELEAVLGAGLEAVVIAGVSSALAAPLLA
GICVTAKDVSQSVAILSGHAPETLPWPAIARMETLIFLMATRSLRYIAEALLRQGRSPTE
GLAILQWAGQPQQQFWFGTLESYLQSPQFPDMAPAVVVIGAIARKRYPLASLDLVFPEFL
RISPSSMSALHGKTILVTRAAAQASDFTQQLTAAGATVLEMPTLEIVPPSSWQPLDQALA
QLDTFDWLILTSHNAVTFFMKRLHSHGKDSRALAGLKIAVVGEKTAQTLNRYGLVADFTP
REFVADALVVEFPEPVAGLRFLFPRVEKGGRPVLGEAFTAAGAEVVEVPAYNSRCPQTVD
APVLAALQAGQVDIVTFTSSKTVKHFCQLVGPQAAELLQNVQIASIGPQTSQTCRELLGR
VDTEATEHTLEGLLQALLRIT
Download sequence
Identical sequences Q8DH05
197221.tlr2155 gi|22299698|ref|NP_682945.1| NP_682945.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]