SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_711925.2.97817 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_711925.2.97817
Domain Number 1 Region: 2-172
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.03e-50
Family Methylesterase CheB, C-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_711925.2.97817
Sequence length 176
Comment chemotaxis-specific methylesterase CheB [Leptospira interrogans serovar Lai str. 56601]; AA=GCF_000092565.1; RF=reference genome; TAX=189518; STAX=173; NAME=Leptospira interrogans serovar Lai str. 56601; strain=56601; AL=Complete Genome; RT=Major
Sequence
MKTILPTLPTQFGIPIVIVQHIGARSDGEWFRILEKLCNIKIKEAEEKEEIKSGMVYVAP
PNYHLLIEKDKTFSFSIGERVNFSRPSIDVLFETASEVYEDKLIGVILTGANSDGAQGLK
KIKENGGLAVVQDPLTAEIALMPRSAIEATSVDYVLSLEKIAELFIRLDQNNLEQR
Download sequence
Identical sequences A0A0E2DLL1 A0A0F6HG06 A0A0F6HVA4 A0A0F6IEN3 A0A0M4N8B2 N1UNQ5
gi|386073877|ref|YP_005988194.1| gi|294827939|ref|NP_711925.2| NP_711925.2.97817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]