SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_733374.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_733374.1.81976
Domain Number - Region: 166-255
Classification Level Classification E-value
Superfamily TPR-like 0.001
Family Tetratricopeptide repeat (TPR) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_733374.1.81976
Sequence length 537
Comment prolyl-4-hydroxylase-alpha NE1 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MRGLVLLVGLIFLLAQGSLASDYFSSITGLEDLLHTEQYLTRELRSKVNAIQTALQQLES
ELSSIEKEHTMAASDTENYLTNPVNVYRLMKRLHTDWSLMEGRVQLMAEEMNFNATREYG
LSYPSQEDVEGAALALVRLQSTYKLDVAQVAQGILNGVKYGSDMSWQDCFELGQQLFEME
DYNNTKVWLRESMERLRRQTSHAPSHLAPTSGPDTVTLNKMEATAKSLFQLGDFDTAFEL
SQRVLQFDPKRIRNWHLGDKGTAPPEDIDDVYLPKHSDSYSLSQEFAKYEKVCRGEVHPI
VRQELRCRYSRGNHPYRFLAPLKLEEHSLDPYVATFHDILSPGKISQLREMAVPRMHRST
VNPLPGGQLKKSAFRVSKNAWLAYESHPTMVGMLRDLKDATGLDTTFCEQLQVANYGVGG
HYEPHWDFFRDPNHYPAEEGNRIATAIFYLSEVEQGGATAFPFLDIAVKPQLGNVLFWYN
LHRSLDKDYRTKHAGCPVLKGSKWIGNVWIHEVTQTFARPCDVFRDHEVSLEYEIIK
Download sequence
Identical sequences Q9VA64
7227.FBpp0085050 NP_733374.1.81976 FBpp0085050 FBpp0085050 FBpp0085050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]