SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_774389.1.11505 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_774389.1.11505
Domain Number - Region: 14-88
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 0.00785
Family Type 2 phosphatidic acid phosphatase, PAP2 0.07
Further Details:      
 
Domain Number - Region: 92-145
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0301
Family NfeD domain-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_774389.1.11505
Sequence length 147
Comment hypothetical protein bll7749 [Bradyrhizobium diazoefficiens USDA 110]; AA=GCF_000011365.1; RF=reference genome; TAX=224911; STAX=1355477; NAME=Bradyrhizobium diazoefficiens USDA 110; strain=USDA 110; AL=Complete Genome; RT=Major
Sequence
MTDTFVSLGTWNWLIFAFILMALETIAPGVFLFWLGLAALLVGLISFAVHLSWQTQLVMF
AIFAAAAVPVWRRLARPRPDASASPFLNKRTEALLGREFTLEKPIVDGNGTMRIGDTVWR
VAGPDTPAGTRVKVVQVDGVNLTVAVA
Download sequence
Identical sequences A0A0E4FRM4 A0A0M9B7K4 Q89CP7
GO.2658 gi|27382860|ref|NP_774389.1| NP_774389.1.11505 WP_011090474.1.15658 WP_011090474.1.2739 WP_011090474.1.53516 WP_011090474.1.53518 WP_011090474.1.67972 WP_011090474.1.69380 WP_011090474.1.90507 224911.bll7749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]