SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_775139.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_775139.1.4139
Domain Number 1 Region: 103-514
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.25e-121
Family Pyridoxal-dependent decarboxylase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_775139.1.4139
Sequence length 568
Comment sphingosine-1-phosphate lyase 1 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MPSTDLLKLKDFEPYLEILEAYSTKAKNYVNGYCTKYEPWQLIAGSVLCTLLVVWVYELI
FQPESLWSRFKNKLFRLIRKMPFIGRKIQQQLTKAKKDLVKNMPFLKLDKDYVKTLPAQG
LSTAEVLERLKEYSSMDVFWQEGKASGAVYSGEPKLTELLVQAYGEFTWSNPLHPDIFPG
LRKLEAEIVRMTCSLFNGGPDSCGCVTSGGTESILMACKAYRDLALEKGIKTPEIVAPES
AHAAFDKAAHYFGMKIVRVAQKKNMEVDVRAMKRAISRNTAMLVCSAPQFPHGVIDPIPE
VAKLAVKYKIPFHVDACLGGFLIVFMEKAGYPLEKPFDFRVKGVTSISADTHKYGYAPKG
SSVVMYSNEKYRKYQFFVDADWQGGIYASPSIAGSRPGGIIAACWAALMHFGENGYVEAT
KQIIKTARFLKSELENIKNIFILGDPQLSVIALGSNDFDIYRLSNMMSAKGWNFNYLQFP
RSIHFCITLVHTRKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQATIDRKMVAE
ISSVFLDSLYSTDPVTQGNQMNGSPKPR
Download sequence
Identical sequences Q8CHN6
ENSRNOP00000059089 ENSRNOP00000000686 NP_775139.1.100692 NP_775139.1.4139 XP_008771092.1.100692 XP_008771093.1.100692 XP_008771094.1.100692 XP_008771095.1.100692 10116.ENSRNOP00000059089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]