SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_775790.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_775790.1.87134
Domain Number 1 Region: 122-287
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.45e-50
Family CRAL/TRIO domain 0.0000285
Further Details:      
 
Domain Number 2 Region: 23-102
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 4.19e-18
Family CRAL/TRIO N-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_775790.1.87134
Sequence length 354
Comment clavesin-1 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MGPVSLLPKYQKLNTWNGDLAKMTHLQAGLSPETIEKARLELNENPDVLHQDIQQVRDMI
ITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQYRQLNLDMFKNFKADDPGIKR
ALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGF
ILIIDWSNFSFKQASKLTPSILKLAIEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFL
KDKTRKRIFLHGNNLNSLHQLIHPEFLPSEFGGTLPPYDMGTWARTLLGPDYSDENDYTH
TSYNAMHVKHTSSNLERECSPKLMKRSQSVVEAGTLKHEEKGENENTQPLLALD
Download sequence
Identical sequences H2QW80 Q8IUQ0
gi|27734849|ref|NP_775790.1| 9598.ENSPTRP00000034727 9606.ENSP00000325506 ENSP00000428174 ENSPTRP00000034727 ENSPTRP00000034727 NP_775790.1.87134 NP_775790.1.92137 XP_003805153.1.60992 XP_016815004.1.37143 XP_016868630.1.92137 XP_016868631.1.92137 XP_519783.2.37143 ENSP00000325506 ENSP00000428402 ENSP00000325506 ENSP00000428402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]