SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_790078.1.37326 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_790078.1.37326
Domain Number 1 Region: 3-108
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.64e-30
Family Frataxin-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_790078.1.37326
Sequence length 110
Comment cyaY protein [[Pseudomonas syringae] pv. tomato str. DC3000]; AA=GCF_000007805.1; RF=reference genome; TAX=223283; STAX=251701; NAME=[Pseudomonas syringae] pv. tomato str. DC3000; strain=DC3000; AL=Complete Genome; RT=Major
Sequence
MSLTEARFHDLVDATQQNIEDVFDESGLDVDLENSAGVLTVKFEGGSQLIFSRQEPLRQL
WLAAKSGGFHFDYDEEESRWACDTSDELLSEMLARMTFEQAGADLDFSEI
Download sequence
Identical sequences A0A099SKL6 A0A0N0WE57 A0A0N8TFQ0 A0A0P9J1U0 A0A0P9JR69 A0A0P9Q7G1 A0A0Q0A2Y8 A0A1H3PF12 A0A261WPM3 A0A2G9L3D0 A0A2K4T9B8 A0A2K4VLQ7 F3ILF4 Q88B06
NP_790078.1.37326 WP_005768497.1.11497 WP_005768497.1.12126 WP_005768497.1.14276 WP_005768497.1.14773 WP_005768497.1.14805 WP_005768497.1.14933 WP_005768497.1.17870 WP_005768497.1.22256 WP_005768497.1.26792 WP_005768497.1.28009 WP_005768497.1.29949 WP_005768497.1.31627 WP_005768497.1.381 WP_005768497.1.41250 WP_005768497.1.45653 WP_005768497.1.49996 WP_005768497.1.52448 WP_005768497.1.58347 WP_005768497.1.60779 WP_005768497.1.60793 WP_005768497.1.6181 WP_005768497.1.62491 WP_005768497.1.64333 WP_005768497.1.6959 WP_005768497.1.69804 WP_005768497.1.71514 WP_005768497.1.7265 WP_005768497.1.80269 WP_005768497.1.83999 WP_005768497.1.87724 WP_005768497.1.88146 WP_005768497.1.92774 WP_005768497.1.93050 WP_005768497.1.99297 gi|28867459|ref|NP_790078.1| 223283.PSPTO_0227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]