SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_810226.1.73244 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_810226.1.73244
Domain Number 1 Region: 170-379
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.44e-49
Family D-glucarate dehydratase-like 0.0001
Further Details:      
 
Domain Number 2 Region: 46-162
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.21e-22
Family Enolase N-terminal domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_810226.1.73244
Sequence length 383
Comment muconate cycloisomerase [Bacteroides thetaiotaomicron VPI-5482]; AA=GCF_000011065.1; RF=reference genome; TAX=226186; STAX=818; NAME=Bacteroides thetaiotaomicron VPI-5482; strain=VPI-5482; AL=Complete Genome; RT=Major
Sequence
MPNRRDFLKTAAFATLGSGIAVSQVLAGECMPSAIHINKYGIGGKMKMTFFPYELKLRHV
FTVATYSRTTTPDVQVEIEYEGVTGYGEASMPPYLGETVESVMNFLKKVNLEQFSDPFQL
EDILSYVDSLSPKDTAAKAAVDIALHDLVGKLLGAPWYKIWGLNKEKTPSTTFTIGIDTP
DVVRAKTKECAGLFNILKVKLGRDNDKEMIETIRSVTDLPIAVDANQGWKDRQYALDMIH
WLKEKGIVMIEQPMPKEQLDDIAWVTQQSPLPVFADESLQRLGDVAALKGAFTGINIKLM
KCTGMREAWKMVTLAHALGMRVMVGCMTETSCAISAASQFSPAVDFADLDGNLLISNDRF
KGVEVVNGKITLNDLPGIGVMKI
Download sequence
Identical sequences Q8A861
gi|29346723|ref|NP_810226.1| 226186.BT_1313 NP_810226.1.73244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]